Which description emphasizes the author’s humorous voice in the story?
a
“and printed on the sidewalk”
b
“drew an outline of the half-dozen”
c
“giving him more muscles and less fat”
d
“ballplayers who were clustered around”

Answers

Answer 1

Hello. You have not shown the text this question refers to. This makes it impossible for your question to be answered. However, I will try to help you as best I can.

An author's humorous voice is how he uses words to make jokes, joking remarks and add humor to a text. In this case, to answer this question, you must read the entire text and identify which of the answer options shown above is presented in the text in a funny way, promoting a joke and establishing the author's humorous position.


Related Questions

How does the author illustrate the importance of radio
telescopes to scientific study?
into

Answers

Answer:

We use radio telescopes to study naturally occurring radio light from stars, galaxies, black holes, and other astronomical objects. We can also use them to transmit and reflect radio light off of planetary bodies in our solar system

Explanation:

Mark brainliest please

What are Radio Telescopes?

Just as optical telescopes collect visible light, bring it to a focus, amplify it and make it available for analysis by various instruments, so do radio telescopes collect weak radio light waves, bring it to a focus, amplify it and make it available for analysis. We use radio telescopes to study naturally occurring radio light from stars, galaxies, black holes, and other astronomical objects. We can also use them to transmit and reflect radio light off of planetary bodies in our solar system. These specially-designed telescopes observe the longest wavelengths of light, ranging from 1 millimeter to over 10 meters long. For comparison, visible light waves are only a few hundred nanometers long, and a nanometer is only 1/10,000th the thickness of a piece of paper! In fact, we don’t usually refer to radio light by its wavelength, but by its frequency.

Naturally occurring radio waves are extremely weak by the time they reach us from space. A cell phone signal is a billion billion times more powerful than the cosmic waves our telescopes detect.

A radio telescope is a form of radio receiver used in astronomy.

In contrast to an "ordinary" telescope, which receives visible light, a radio telescope "sees" radio waves emitted by radio sources, typically by means of a large parabolic ("dish") antenna, or arrays of them.

Many celestial objects, such as pulsars or active galaxies (like quasars), produce radio-frequency radiation and so are best "visible" or even only visible in the radio region of electromagnetic spectrum.

By examining the frequency, power and timing of radio emissions from these objects, astronomers can improve our understanding of the Universe.

Radio telescopes are also the primary means to track space probes, and are used in the SETI project.



who is a kpop stand here?

Answers

Answer:

im a kpop stand :D

I stand bts and other groups!

Explanation:

Answer:

Meeeee I Stan

Explanation:

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

Which of the following activities should one practice when doing a close reading?
Select all that apply.

Read a passage multiple times.

Underline words and phrases that seem important or that you don't understand.

Draw lines to connect ideas, actions, or other elements to
one another.

Highlight most of the passage as you read through it.

Avoid pauses or stopping to reflect on what you're reading.

Answers

Answer: Read a passage multiple times, Underline words, Draw Lines, and Avoid Pauses.

Explanation: The "Highlight Most Of The Passage" seemed a bit confusing especially since you should only highlight words/sentences that you need and not "most of the passage". Hope this helps!

which detail signals an appeal to pathos



what response does lincoln with to achieve by using the words anxiously, impending, and dreaded?

Answers

Answer:

"all dreaded it"

fear

Explanation:

cause i got it right

"all dreaded it" is the detail signals an appeal to pathos. the sentence is what response does lincoln with to achieve by using the words anxiously, impending, and dreaded?

What is pathos?

A teenager tries to persuade his parents to buy him a new car by claiming that if they cared about their child's safety, they would upgrade him. A customer at a car dealership begs the salesperson to give him the greatest bargain possible on a new vehicle since he must provide for his growing family.

By constructing logical arguments, Logos appeals to the rational side of the listener. By appealing to the speaker's status or authority, ethos increases the likelihood that the audience will believe them. In order to evoke certain feelings in the audience, such as anger or sympathy, pathos uses emotional appeals.

Thus, "all dreaded it"

For more information about pathos, click here:

https://brainly.com/question/26294668

#SPJ2

Musee des Beaux Arts by W. H Auden About suffering they were never wrong, The old Masters: how well they understood Its human position: how it takes place While someone else is eating or opening a window or just walking dully along: How, when the aged are reverently, passionately waiting For the miraculous birth, there always must be Children who did not specially want it to happen, skating On a pond at the edge of the wood: They never forgot That even the dreadful martyrdom must run its course Anyhow in a corner, some untidy spot Where the dogs go on with their doggy life and the torturer's horse Scratches its innocent behind on a tree. In Breughel's Icarus, for instance: how everything turns away Quite leisurely from the disaster, the ploughman may Have heard the splash, the forsaken cry. But for him it was not an important failure; the sun shone As it had to on the white legs disappearing into the green Water, and the expensive delicate ship that must have seen Something amazing, a boy falling out of the sky. Had somewhere to get to and sailed calmly on. Which of the following is a descriptive image from the poem above? O "About suffering they were never wrong" "That even the dreadful martyrdom must run its course" "white legs disappearing into the green" "They never forgot"​

Answers

Answer:

white legs disappearing into the green

Prepare a notice to put up on the school
notice board about a seminar on the topic 'Tea and health Benefits (30 to 40 words)
Menuon the Venue date and Time of the Seminar

Answers

Answer:

Lincoln School

Notice

10th June 2021

Tea and Health Benefits

All students are invited to the seminar about tea and its health benefits on Friday 30th, at 6:00 pm in Fulton Street 234, Collin Venue. Limited places.

Sara Johnson

Secretary

Explanation:

A notice has to be short, formal, and precise. It should start with the name of the institution, then the title notice. After that, we write the date that the notice is published, a heading with the topic, a short paragraph with the time, date, place, intended public, and any necessary information. Then the signature.

Haven`t they reserved the rooms?(Change into passive)

Answers

‘Haven’t the rooms been reserved by them?’

Regards,
ArmyCee:)

Read the sentence.

The harsh wind scoured the scant remaining leaves from the trees, and a desolate landscape remained in its wake.

The underlined portion of the sentence is

A.) a coordinating conjunction.
B.) a dependent clause.
C.)an independent clause.
D.)a subordinating conjunction.

Answers

Answer: C.)an independent clause

Explanation: An Independent clause is the one that conveys a complete thought and contains enough information to stand on its own.

Answer:

C.

Explanation:

I did the test. Its an independent clause. The underlined portion is "a desolate landscape remained in its wake."

The mood of a story is the

Answers

Answer:

Please add a picture or something

Explanation:

I would to help you since I love books and writing! :)

add a picture , or options so we know what ur talking abt

WILL MARK BRAINLIEST IF CORRECT.

Under which act would an artist whose painting was uploaded online as a digital image still retain the rights to his or her image?

Web Uploading Fair Use Act

Internet Trademark Act

Digital Millennium Copyright Act

Cyberspace Epoch Act

Answers

Answer:

internet trademark act

Answer: Digital Millennium Copyright Act

Explanation: hope this helps! :)

In his speech, "Beyond Vietnam - A Time to Break Silence," Martin Luther King argues that American involvement in the Vietnam war is unjust? What is his reasoning that supports his claim? What devices and appeals does he use to build his claim? Finally, is his argument justified?

Answers

Answer and Explanation:

1. It shows that the war is unfair, because in addition to causing pain and suffering to Vietnamese and American soldiers, it withdraws money that could be used to improve the lives of poor and needy Americans.

2. He supports this claim by showing that before the war the US government had social programs that helped American citizens, black and white, economically. These citizens did not have economic resources to have food and a home, but thanks to social programs, thanks to population taxes, the government was able to help these Americans to have a better and happier life. However, when the war began, these programs were terminated so that this money could be used to pay the costs of the war. This left many Americans destitute and taxes paid by the population were used to wreak havoc in another country.

3. King uses emotional resources through a strong appeal to pathos to create public sympathy with what he was presented. This can be seen in the moment when he says that poor Americans are helpless, Vietnamese are suffering from the war and Americans are watching their children, grandchildren and husbands being killed in a war that could be avoided.

4. King's argument is justified, as it shows correct evidence that can be recognized as true by the public.

What is the meaning of quetzal?​

Answers

Answer:

Quetzals are a colorful type of bird belonging to the trogon family. They are reportedly said to be found in forests especially in the humid highland regions. These birds usually have red colored bellies, and their heads and back usually colored in green or golden color. Due to the vibrant color scheme possessed by Quetzals, they have been adopted as the national bird of Guatemala. Different Quetzals species have been reportedly found in Mexico, The United States and Guatemala. Quetzals mostly feed on insects, berries and fruits.

Explanation:

Kindly check answer.

define the 5 plot orders

Answers

Answer:

1. Exposition/introduction- in storytelling the exposition is the additional information, most often provided through narration, that makes readers familiar with the world of your story.

2. Rising action- The rising action of a story is the section of the plot leading up to the climax, in which the tension stemming from the story's central conflict grows through successive plot developments

3. Climax/turning point- the turning point or climax is the point of highest tension in a narrative; it’s the most exciting and revealing part of a story. It leads the rising action into the falling action before a story is resolved and reaches the conclusion

4. Falling action- Falling action occurs right after the climax, when the main problem of the story resolves.

5. Resolution/denouement- is the conclusion of the story's plot. It is when the story begins to slow down and work towards its end, tying up loose ends of the plot.

:333

Explanation:

Which area of a notes organized would contain the following information

Answers

The section that will most likely contain this information is the vocabulary. The vocabulary section is the part that includes words that are unknown or new to the organizer...

In the movie Thor (2011), Thor and his brother Loki physically battle for the throne. Which term describes the conflict best?

Answers

The movie si a dvd and my A si the beta

What role should the government place in encouraging or requiring people to be conscious of the environmental impact of their actions?

Answers

The government has an indisputable role in the exponential decline of our environment. It is not just the governments responsibility, but their moral obligation to take severe steps to take control of the climate catastrophe. This includes putting regulations not just on themselves, but big corporations and people. The fact is that the government has been in support of things such as oil mining, and mass fishing, and even dumping trash into the ocean. These are all things that gain mass media coverage that the government has the ability to enact legislature that can prevent this from being legal. It is incredibly important to push the line from a moral obligation, to just an obligation. With the rapid decline of the world, there is not time to get people of board with being willing to do their part. They will however stop at traffic lights and pay their taxes. That's exactly what the government must do now. Treat climate issues like any other citizen obligation. With refusal to comply being punished through hefty fines. There needs to be accountability for big corporations as well, and a check and balance to make sure they cannot pay their way out of responsibility.

I was once told that time heals but u never forget the 1st person u pictured yourself spending the rest of ur life with. True of false?

Answers

Answer:

true

Explanation:

Answer:true

Explanation:

Because it is a memory it’s loved into your brain I can remember 300 faces with out even knowing who they are

If the word rudiment is defined as a fundamental principle or skill, and the suffix -ary is defined as "of or relating to,” what does the term rudimentary education mean?

the education necessary for getting a job
a manual education
an education gained through hard work
a basic education

Answers

The answer is option 3 an education gained through hard work

The term rudimentary education means  A basic education. Thus the correct option is D.

What is a dictionary entry?

A dictionary entry refers to the collection of information provided to understand the meaning of a word in a given context. This word of meaning will differ from context to context sometimes.

The term "skills" refers to a person's distinctive characteristics, traits, abilities, and capabilities that set them apart from others and provide them a competitive advantage in the workplace and in life.

It is explained in the example given that if the term "rudiment" is defined as a fundamental idea or ability and the suffix "-ary" is defined as pertaining to a basic education that any individual seeks in order to get good growth.

Therefore, option D is appropriate.

Learn more about Dictionary, here:

https://brainly.com/question/1199071

#SPJ7

Which example from "Speech After Being Convicted of Voting" is the most
rhythmic and most likely to keep the audience engaged?

Answers

Answer:

B.

Explanation:

Select two sentences in the passage that best show that Mr. Auld views education and slavery as incompatible.

Very soon after I went to live with Mr. and Mrs. Auld, she very kindly commenced to teach me the A, B, C. After I had learned this, she assisted me in learning to spell words of three or four letters. Just at this point of my progress, Mr. Auld found out what was going on, and at once forbade Mrs. Auld to instruct me further, telling her, among other things, that it was unlawful, as well as unsafe, to teach a slave to read.Now, if you teach that [Douglass] how to read, there would be no keeping him. It would forever unfit him to be a slave. He would at once become unmanageable, and of no value to his master.

Answers

Answer:

1. Just at this point of my progress, Mr. Auld found out what was going on, and at once forbade Mrs. Auld to instruct me further, telling her, among other things, that it was unlawful, as well as unsafe, to teach a slave to read.

2. He would at once become unmanageable, and of no value to his master.

Explanation:

The two sentences above show that Mr. Auld did not think that education and slavery were compatible. On learning that Frederick Douglass was now learning how to read and write from his wife, he immediately stopped her, insisting that it was not safe to teach a slave how to read and write.

He reasoned that if Douglass became literate, he would become unmanageable. He might now challenge the authority of his master and become of no use to him.

i am from spain, can you help me with this please​

Answers

Hello! My name is Laura and I am thirteen. These are my two cats. They are very friendly. This is my room. It is quite small and there are lots of books and posters on the walls. These are my brothers, Andy is ten and David is fifteen. We are british, but my mum is from California.

What is the appropriate personal pronoun for the bold words in the following sentence? Yes, Tina and Lil will enjoy it very much.​

Answers

it is tell them to learn it themself

Describe one setting from the novel "walk two moons" and explain why it is important to a character or to the plot?

Answers

One setting from Walk Two Moons is Bybanks, Kentucky. It is important to a character because it is the place where, Salamanca Tree Hiddle, the 13-year-old main character, calls her home. She has wonderful memories with her mother there, and that's very special to her.  

Bybanks, Kentucky is one of Walk Two Moons' locations. Because the primary character, 13-year-old Salamanca Tree Hiddle, calls it home, it is significant to that character.

What is a character?

A character in fiction is a human or other being who appears in a story. The distinction between a "real" and "fictional" character may be made depending on whether the character is wholly imaginary or is based on a real-life person.

The English word, which is derived from the Ancient Greek, was first used during the Restoration, though it gained widespread usage after Henry Fielding used it in Tom Jones in 1749.

This led to the development of the concept of "a part played by an actor." Character entails "the illusion of being a human person," especially when performed by an actor in a play or movie.

An examination of a character's relationships with every other character in the book is necessary for character analysis. A character's unique status is established by the network of oppositions it forges with the other characters.

Historical variations in the relationships between characters and the plot's action frequently mirror changes in society's conceptions of human individuality, self-determination, and social order.

Learn more about character, here

https://brainly.com/question/13141964

#SPJ5

Read the excerpt from act 5, scene 2, of Julius Caesar.

BRUTUS. Ride, ride, Messala, ride, and give these bills
Unto the legions on the other side.

[Loud alarum]

Let them set on at once, for I perceive
But cold demeanour in Octavius’ wing,
And sudden push gives them the overthrow.
Ride, ride, Messala, let them all come down.

[Exeunt]

How would the meaning of the passage be affected if the phrase "all come down” were changed to "advance”?

The tone would become one of despair and negativity.
The tone would become more angry and vengeful.
The tone would be less urgent as the enemy moves more slowly.
The tone would become one of indifference as both sides act indecisively.

Answers

Answer:

C

Explanation:

The tone would be less urgent as the enemy moves more slowly. edg 2021

if "all come down" was replaced to "advance" Due to the enemy's slower movement, the tone would be less urgent. Hence, the answer is (C).

Who was julius Caesar?

The First Triumvirate was an informal political coalition that was founded in 60 BC by julius Caesar, Crassus, and Pompey. It ruled Roman politics for several years. The Optimates, including Cato the Younger, who frequently had Cicero's support, fought their attempts to consolidate power as Populares within the Roman Senate.

By a series of military triumphs in the Gallic Wars, which were finished by 51 BC and significantly increased Roman territory, julius Caesar advanced to become one of the most influential statesmen in the Roman Republic.

He also constructed a bridge over the Rhine when invading Britain around this time. These successes, along with the backing of his seasoned army, posed a challenge to Pompey's standing with the Senate, who had realigned himself with it following Crassus' death in

Learn more about julius Caesar, from :

brainly.com/question/30160306

#SPJ6

hi guys I'm new here ​

Answers

Hello!!!!!!!

How are you??

Answer:

Hii!!

Explanation:

How are you???...

Read the excerpt from The Life of a Polish Peasant. Every farmer had first to do his dues at the manor house, whether with his team or on foot. Only then could he work his own land, sowing and reaping at night. No excuse as to pressing needs at home was of any use. If one did not appear as ordered, at once the overseer would come. If he found the wife busy cooking he would throw a pail of water on the fire. On the basis of the excerpt, why would an overseer throw water on a fire

Answers

Answer: d)He disapproved of the peasants spending time on their own needs.

Explanation:

Here are the options given:

a)He wanted to help the peasants get their work done more quickly.

b)He thought the fire was a potential hazard to the manor.

c)He believed everyone should eat only at the manor house.

d)He disapproved of the peasants spending time on their own

An overseer will throw water on a fire in a situation whereby a farmer doesn't pay his dues at the manor house. There are no excuses why the dues shouldn't be paid.

Therefore, the correct option is "disapproved of the peasants spending time on their own needs".

Answer:

it's A

Explanation:

got it right on ede2020

What would you like to change about yourself if you can?

Answers

Answer:

anything and ajdnissjjd

Explanation:

djsjjjddk

Answer:

My reactions

Explanation:

I often find myself becoming very defensive and angry when it comes to people who have thoughts and ideas that oppose mine. It's not that they oppose mine, but when they are being lied to then I get upset. I would like to become someone who is slow to anger

Read the sentence below and answer the question.

I waited until 7 o'clock, but my friends never showed up to see the movie.

Which of the following groups of words make up the prepositional phrase in the sentence above?

a. until 7 o'clock
b. to see the movie
c. but my friends
d. never showed up

Answers

The answer is b because it says "to"

Read Josh's draft.
Floating Entertainment
During the mid-19th century, before television or movies existed, people enjoyed forms of entertainment that are no longer common today.
For example, people who lived in areas along the Mississippi River that were far from large cities depended on showboats. Showboats were boats
on which plays were performed
An actor named William Chapman was the first person to build a showboat. He called his showboat the "Floating Theater." Actors lived on
the boat and traveled along the river. The showboat stopped at small towns to perform plays.
Showboats were very popular but were discontinued when the Civil War began in 1861. They became popular again in the late 1870s.
However, by the early 1900s, many settlements along the Mississippi had grown into larger towns with dance halls and movie theaters. As a result,
Mississippi showboats began to lose their appeal. By 1910, people were heading to movie theaters big time.
Josh wants to revise his last sentence.
Is Josh's decision to revise his last sentence correct?
O 1. No, because the information in the sentence provides a strong conclusion,
O 2. No, because the information in the sentence is essential to the topic's main idea.
O 3
Yes, because the sentence includes a factual statement instead of a personal opinion.
4. Yes, because the sentence contains slang and differs in style from the rest of the draft.
Question #4
Language 2-12 CA 2010

Answers

Explanation:

Technology has the power to affect not only education but also culture, religion and personal thoughts and beliefs. While the world population is continually growing, our global world seems to be getting smaller as we are able to connect to people in a way that was never imagined. Radio and television were among the early contributors to this new form of mass media and played a role in affecting world political views and religious beliefs as well as changing how we view literacy in an educational setting.

Other Questions
Qu significa ELLA en ingls?HeYouWeSheI Based on the text what is the difference in time between practing for the Paralympic basketball team and for track and field Help me out plssssss and thanks !!!!!!! Select the correct answer.What is the factored form of this expression?-12x+36.(x - 12)(x-3)O B. (x - 6)^2OC. (x + 6)^2OD. (x-6)(x+6) Why was Princeton significant in the revolutionary war in 1776 PLEASE HELP ME !!!! WILL GIVE BRAINLIEST TO WHOEVER ANSWERS CORRECTLY However you may have reformed your life in many things, and may have had religious affections, and may keep up a form of religion in your families and closets, and in the house of God, it is nothing but his mere pleasure that keeps you from being this moment swallowed up in everlasting destruction. Jonathan Edwards What is the denotation of everlasting in this passage? i need help! plz (listing BRAINLIST and giving points) :D Solve the equation 3/4x+3-2x= -1/4+1/2x+5Please help I have tried everything and I havent gotten the right answer and it wont let me move on ExerciseWrite the words in the correct part of the table.Some have one initial consonant, some two andsome three. Remember that it is the pronuncia-tion, not the spelling, that is important.skystraightcrabsscratchjarbeepneumonia flyjuicesuitehorseBritaintrayshrinkchoir. pls help.i promise to give you a brainlest. pls help me locate the words to either one initial consonant , two initial consonant and three initial consonant.Thank you On the first day of camp, 5/8 of the skaters were beginners. Of the beginners, 2/6 were girls. What fraction of the skaters were girls and beginners? Complete the explanation. Will choose brainliest! Please help! (This is Khan Academy) In a survey of 2,700 people who owned a certain type of car, 954 said they would buy that type of car again. What percent of the people surveyed were satisfied with the car? What would you change about yourself if you could?answer honestly i wont judge :D A proteins what can be described as the local folding of a polypeptide Calcula el volumen. Largo: 50cm Largo: 35cm Largo: 40cm Ancho: 30cm Ancho: 20cm Ancho: 60cm Alto: 20cm Alto: 50cm Alto: 30cm Volumen: ___________ Volumen:______ Volumen:_______ Find two consecutive whole numbers that square root of 63 lies between The formula for the lateral area of a right cone is LA = rs, where r is the radius of the base and s is the slant height of the cone.Which are equivalent equations? Select two correct answers. Waves are generated when energy passes through causing them to move matter through ____ ? The one-to-one functions g and h are defined as follows