What is a benefit of playing music hurrry

What Is A Benefit Of Playing Music Hurrry

Answers

Answer 1
Music can help memory
Answer 2
Music Can help your memory

Related Questions

The conflict between the twins continued, and for some reason, the grandmother favored the left-handed twin. The right-handed twin became angry and resentful. He was the truthful twin who always did the right thing. The left-handed twin was deceitful and did everything backward. You could never trust him.

The twins represented the two ways of the world which are in all people. The Indians did not call these good and evil. They called them the straight mind and the crooked mind, the righteous man and the devious man, the right and the left.

The main purpose of this excerpt is to
demonstrate that right-handed people are good and left-handed people are bad.
explain why some people do the right thing and others do not.
provide the reason why the grandmother favored the left-handed twin.
clarify what the Iroquois considered the two different sides of human nature.

Answers

Answer:

clarify what the Iroquois considered the two different sides of human nature.

Explanation:

Answer:

The main purpose of this excerpt is to

demonstrate that right-handed people are good and left-handed people are bad. explain why some people do the right thing and others do not. provide the reason why the grandmother favored the left-handed twin. clarify what the Iroquois considered the two different sides of human nature. <<<---CORRECT

Explanation:

Edge2021

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

The purpose of paraphrasing Shakespeare's text is to?

Answers

Answer:

in my opinion Shakespeare's text is to show what true love is. that no matter what happens they will be true loves forever

Explanation:

if u want u can add on this is just my opinion

Re write: "She never seems to succeed even though she works hard." with However

Answers

she never seems to excel in whatever she does although she pours all her time and attention into it.

The fearful passage of their death-mark'd love,

And the continuance of their parents' rage,

Which, but their children's end, nought could remove,

Is now the two hours' traffick of our stage

—Romeo and Juliet,
William Shakespeare

Paraphrase these lines from the prologue in two to three sentences.

Answers

Answer:

Explanation:

This play will show you the consequences of the ongoing fights of two families in the duration of two hours. The result of these two families' quarrels will be the untimely death of their children who were in love.

Answer:

The play is about the frightening path of the children's doomed love and the constant anger of their parents. Only the children's death could end the fight. This is the story for the rest of the play.

Explanation:

Sample Passage

(from The Strange Case of Dr. Jekyll and Mr. Hyde, by Robert Louis Stevenson)

Read the passage carefully and then answer the question.

Two doors from one corner, on the left hand going east the line was broken by the entry of a court; and just at that point a certain sinister block of building thrust forward its gable on the street. It was two storeys high; showed no window, nothing but a door on the lower storey and a blind forehead of discoloured wall on the upper; and bore in every feature, the marks of prolonged and sordid negligence. The door, which was equipped with neither bell nor knocker, was blistered and distained. Tramps slouched into the recess and struck matches on the panels; children kept shop upon the steps; the schoolboy had tried his knife on the mouldings; and for close on a generation, no one had appeared to drive away these random visitors or to repair their ravages.

Mr. Enfield and the lawyer were on the other side of the by-street; but when they came abreast of the entry, the former lifted up his cane and pointed.

"Did you ever remark that door?" he asked; and when his companion had replied in the affirmative. "It is connected in my mind," added he, "with a very odd story."

"Indeed?" said Mr. Utterson, with a slight change of voice, "and what was that?"

The word in bold is an example of what kind of tone?

A. uninviting.

B. confusing.

C. exciting.

D. thrilling.

Answers

Unfortunately, I don't see a word in bold. I'd love to help, but I need the word.

Which sentence from the advertisement insults people who don't have a Superforce 80?
A There is a limited supply.
B Everyone is asking for a Superforce 80.
C Are you in for a treat?
D Don't be left behind in the 20th century.

Answers

I think it’s D? It’s calling people who don’t have a Superforce 80 outdated.

Read Josh's draft.
Floating Entertainment
During the mid-19th century, before television or movies existed, people enjoyed forms of entertainment that are no longer common today.
For example, people who lived in areas along the Mississippi River that were far from large cities depended on showboats. Showboats were boats
on which plays were performed
An actor named William Chapman was the first person to build a showboat. He called his showboat the "Floating Theater." Actors lived on
the boat and traveled along the river. The showboat stopped at small towns to perform plays.
Showboats were very popular but were discontinued when the Civil War began in 1861. They became popular again in the late 1870s.
However, by the early 1900s, many settlements along the Mississippi had grown into larger towns with dance halls and movie theaters. As a result,
Mississippi showboats began to lose their appeal. By 1910, people were heading to movie theaters big time.
Josh wants to revise his last sentence.
Is Josh's decision to revise his last sentence correct?
O 1. No, because the information in the sentence provides a strong conclusion,
O 2. No, because the information in the sentence is essential to the topic's main idea.
O 3
Yes, because the sentence includes a factual statement instead of a personal opinion.
4. Yes, because the sentence contains slang and differs in style from the rest of the draft.
Question #4
Language 2-12 CA 2010

Answers

Explanation:

Technology has the power to affect not only education but also culture, religion and personal thoughts and beliefs. While the world population is continually growing, our global world seems to be getting smaller as we are able to connect to people in a way that was never imagined. Radio and television were among the early contributors to this new form of mass media and played a role in affecting world political views and religious beliefs as well as changing how we view literacy in an educational setting.

please help me immediately​

Answers

i know the first one is synonym i don’t know the other :(

Haven`t they reserved the rooms?(Change into passive)

Answers

‘Haven’t the rooms been reserved by them?’

Regards,
ArmyCee:)

The mood of a story is the

Answers

Answer:

Please add a picture or something

Explanation:

I would to help you since I love books and writing! :)

add a picture , or options so we know what ur talking abt

The ozone layer contains about _____percent of atmospheric ozone.
a) 60
b) 75
c) 90
d) 99

Answers

Answer:

60

Explanation:

The earth is shielded from the dangerous UV rays of the sun by the ozone layer, an area of the stratosphere with high ozone concentrations. The ozone layer contains about 60% atmospheric ozone. The correct option is a.

The region of the upper atmosphere between 15 and 35 km (9 and 22 miles) above the surface of the Earth that is known as the ozone layer, also known as the ozonosphere, contains relatively high concentrations of ozone molecules (O₃).

Due of its ability to absorb a variety of UV light, ozone is incredibly valuable. Even low-energy UV radiation can cause an ozone molecule to split into a regular oxygen molecule and a free oxygen atom.

Thus the correct option is a.

To know more about ozone, visit;

https://brainly.com/question/29795386

#SPJ4

who is a kpop stand here?

Answers

Answer:

im a kpop stand :D

I stand bts and other groups!

Explanation:

Answer:

Meeeee I Stan

Explanation:

What word in Excerpt B has the same root word as
intercept from Excerpt A?
Excerpt A:
Excerpt B:
This would allow Eve to intercept the message as
it is typed into the computer, before it is
encrypted.
-The Code Book,
Simon Singh
What word part is used to change the part of speech of
the word intercept to the new part of speech of the
word in Excerpt B?
What part of speech is this new form of the word, as
used in Excerpt B?

Answers

Answer:

The word that has the same root word as "intercept" is: interception.

The word part which is used to change the part of speech of the word intercept to the new part of speech is: -ion (suffix)

The part of speech this new form of the word is: noun

Explanation:

We can easily see that the words "intercept" in excerpt A and "interception" in excerpt B are very similar. What is the difference between them? Notice that "interception" has some extra letters: -ion. This is a suffix, that is, a group of letters added to a word with the purpose of changing it. While "intercept" is a verb, "interception" is a noun, precisely because of the addition of the suffix. "Interception" means the action of intercepting, that is, of preventing someone or something that is moving toward a destination.

Answer:

1) A- Interception

2) C- -ion

3) C- noun

Explanation:

Which best completes this summary of the first paragraph of The Dark Game?

In 1861, many did not believe the Civil War would last long; however,

Answers

Answer:

In 1861, many did not believe the Civil War would last long; however, the fighting lasted four years.

Explanation:

The Civil war was the deadliest war in the United States of America, the president at the time Abraham Lincoln wanted to abolish slavery and the fight between the Union and The Confederate States became brutal, this was a very long war were many died from little young to elderly fought. In this line, the word "however" is an expression of contrast in the ideas, which makes "the fight lasted four years" the best answer from being opposite to the first sentence that says people did not believe it would last long

Plz give me 5 stars :)

In 1861, many did not believe the Civil War would last long; however, they were proven wrong when it became clear that the conflict would continue for years. This presented a unique opportunity for spies from both the Union and the Confederacy to gather intelligence and turn the tide of the war.

What is the summary of "The Dark Game"?

The given incomplete summary describes the content of the first paragraph of the book "The Dark Game". The paragraph introduces the reader to the topic of espionage during the Civil War. It explains that when the war began in 1861, many people believed it would end quickly. However, as time passed, it became clear that the conflict would continue for years, presenting a unique opportunity for both the Union and Confederacy to gather intelligence and gain an advantage over each other.

Hence, In 1861, many did not believe the Civil War would last long; however, they were proven wrong when it became clear that the conflict would continue for years. This presented a unique opportunity for spies from both the Union and the Confederacy to gather intelligence and turn the tide of the war.

Learn more about the summary of "The Dark Game" here.

https://brainly.com/question/12997710

#SPJ5


Look carefully at the picture and describe what you say do not say the name of the person please just describe what you see thanks

Answers

Answer:

a soccer player or a sports player winning or celibratiing becouse they look happy

hope I helped

Using 2y + 6 = 5, which of
the following statements is not
correct? *
O A) 6 and 5 are coefficients
O B) It has 3 terms
O C) y is known as the variable
O D) The above is an equation
0 This is a required question​

Answers

Explanation:

The correct answer is A

6 and 5 are constants, 2 is the coefficient.

[tex] \blue{\huge{\red{\boxed{\green{\mathfrak{AWSWER}}}}}} [/tex]

A) 6 and 5 are coefficients

[tex] \orange{\underline{\huge{\bold{\textit{\green{\bf{EXPLANATION}}}}}}} [/tex]

2y+6=5

2y=(-1)

y=(-0.5)

coefficients --> 2

constants--> 6&5

variable--> y

equation--> 2y+6=5

Which is NOT an example of reference material?

Answers

opinions are NOT an example of reference material

Taking good notes helps you do all of the following except

Answers

Answer:

Deemphasizing

Explanation:

The art of the chicano movement, and the movement of the Chicano art What connection does the author make between literacy and art

Answers

Hi. You did not enter the text to which this question refers, which makes it impossible for it to be answered. However, I will try to help you as best I can.

To answer this question, you will need to read the text it is related to. During this reading, you will be able to identify the connection between literacy and art through the relationship that the author establishes between these two elements, that is, the author will demonstrate a type of relationship between art and literacy, capable of creating good and positive for something or someone.

Using the chart of word affixes, which is the most likely meaning of the word epidermis​

Answers

Answer:

A.

Happy learning!

--Applepi101

Answer: The outer layer of skin

Explanation:

Trust me love

uneasy lies the head that wear the Crown

Answers

Answer:

from my own personal view this means that with great power comes great responsibility.

Sort the tiles to show the causal relationships between the events.
The pigs oppress the animals.
The animals rebel against Mr. Jones
Mr. Jones oppresses the animals.
The pigs take over as leaders

Answers

Answer:

The pigs oppress the animals- The pigs take over as leaders.

Mr. Jones oppresses the animals- The animals rebel against Mr. Jones.

Explanation:

Causal relationships refer to the phenomena when one thing results in another. In other words, the event when one event triggers or brings upon a reaction and causes another event is known as a causal relationship. It is also known as a cause-effect relationship.

In George Orwell's "Animal Farm", causal relationship happens in the following pairs-

The pigs oppress the animals (CAUSE)- (EFFECT) The pigs take over as leaders.

Mr. Jones oppresses the animals(CAUSE) - (EFFECT) The animals rebel against Mr. Jones.

Answer: The answers are in order first to last look at the explanation and pic below!

Explanation: Trust Me! It is correct!

Sort the tiles to show the causal relationships between the events.

Mr. Jones oppresses the animals. The animals rebel against Mr. Jones. The pigs take over as leaders. The pigs oppress the animals.

Did it on Edge it is correct! I hope this helps! If you found any of my answers helpful please like and choose my answer as Brainliest.

I would appreciate it!  Good luck everyone! :)

What would you like to change about yourself if you can?

Answers

Answer:

anything and ajdnissjjd

Explanation:

djsjjjddk

Answer:

My reactions

Explanation:

I often find myself becoming very defensive and angry when it comes to people who have thoughts and ideas that oppose mine. It's not that they oppose mine, but when they are being lied to then I get upset. I would like to become someone who is slow to anger

define the 5 plot orders

Answers

Answer:

1. Exposition/introduction- in storytelling the exposition is the additional information, most often provided through narration, that makes readers familiar with the world of your story.

2. Rising action- The rising action of a story is the section of the plot leading up to the climax, in which the tension stemming from the story's central conflict grows through successive plot developments

3. Climax/turning point- the turning point or climax is the point of highest tension in a narrative; it’s the most exciting and revealing part of a story. It leads the rising action into the falling action before a story is resolved and reaches the conclusion

4. Falling action- Falling action occurs right after the climax, when the main problem of the story resolves.

5. Resolution/denouement- is the conclusion of the story's plot. It is when the story begins to slow down and work towards its end, tying up loose ends of the plot.

:333

Explanation:

Which word from paragraph 1 helps the reader understand the meaning of the word compassion in paragraph 1?

A. admired
B. cared
C. dignity
D. hope

Answers

Answer:

B cared

Explanation:

Answer:

B cared

Explanation:

compassion - cared

Real or not real?
(Get the reference?)

Answers

Answer:

Not real

Explanation:

Life is a lie… ;)

Answer:

Explanation:

really

Generations of Hawaiians have told the story of Hawai'iloa, a Polynesian navigator who accidentally landed upon
the Hawaiian islands. Hawai'iloa fell in love with the fertile lands, where coconuts grew in abundance. The island
of Hawaii was named in his honor. However, some people question the authenticity of the legend, claiming that
parts of it grew from the imaginations of the people who passed it down from generation to generation. A second
legend about early migration to Hawaii features Pa'ao. He was a Tahitian priest who heard the wind tell him to
steer toward the islands, which his family then colonized.
Do It!
These stories reflect Hawaiian
A generosity
B choreography
C mythology
D monarchy

Answers

Answer:

Answer: D

Explanation:

The correct option is D. These stories reflect the Hawaiian monarchy.

From 1810, when Kamehameha I (1738-1819) brought all the islands under his rule, to the time the monarchy was abolished under Lili'uokalani, Hawaii was a united kingdom under a single monarch for only eighty years.

Why was the Hawaiian monarchy overthrown?

The Queen had been ousted by pro-American economic forces after she rejected constitutional restrictions on her authority. Hawaii was too little and militarily insignificant to exist in a world of aggressive imperialism, particularly on the part of Japan, the new government knew. It was eager for annexation by America.

When Queen Liliuokalani was coerced into abdicating by a group of businessmen and sugar planters, Hawaii's monarchy was abolished. The coup caused the Kingdom of Hawaii to be dissolved two years later, incorporated as a U.S. territory, and eventually admitted as the 50th state into the union.

Thus, The right answer is D. The Hawaiian monarchy is reflected in these tales.

Learn more about the Hawaiian monarchy here:

https://brainly.com/question/2688991

#SPJ6

Fill in the correct wo A number of girls..... fighting in school. (was, were, have)​

Answers

Answer:

A number of girls "were" fighting in school.

Explanation:

A number of girls was fighting in school.

Legal over the counter drugs can be displayed in a pharmacy or a shop?

True
False
Maybe

Answers

True yhunininomoibunij
Other Questions
10) Why did the United States declare war on Japan?a) The Japanese invaded Manchuriab) The Japanese took Control of the Philippinesc) The Japanese attacked Pearl Harbord) The Japanese froze the US assets in Japan Easy question please help How many 1/6 cup serving of rice and in 2/3 cup of rice If 30 men can complete a work in 40 days,In how many days 15 men will completeit? In what form is energy that is NOT used for life processes released from living things? 1. Thermal energy 2. Chemical energy 3. Light energy 4. Sound energy Solve the problem 352/7= The function C(x) = 400x - 0.2x ^ 2 represents the total costs for a company to produce a product, where in dollars and x is the number of units sold. Which statement is true? is the total cost Which expression is equivalent to(3m + 5m - 2) + (-2m +18)?Someone answer ASAP For each sequence, find the first 4 terms and the 10th term.a) 12-nB 5 - 2n Is this a chemical reaction? factorize: 9x^2 - 24xy + 16y^2 Which expression is equivalent to 1/2x + 8 Find the angle for this problem Please help I need it!!! Profit-maximizing monopolists never produce in the range of output where MR is negative because To produce hydroelectric power, ____ is needed.a.a fossil fuelc.Sunb.flowing waterd.windPlease select the best answer from the choices providedABCD La televisin persuasiva Los medios de comunicacin social, principalmente la televisin, se han convertido en medios muy influyentes en la cotidianidad de las personas [...]. La influencia de la televisin es peculiar, interesante y peligrosa. La persuasin es la tcnica ms utilizada: un propsito consciente de formar, reforzar o cambiar actitudes, creencias, opiniones, percepciones o conductas de alguna persona. Consiste en influir sobre los dems para hacerlos pensar de un modo determinado, rechazar algo o adaptarlo, o inducirlos a realizar una accin determinada. que impacto tendria en una comunidad por favor responder antes de hoy a las 5 pm Simplfiy the expression 12/c^-8d^2? Some industries competition is much more intense than others. Retail grocery stores such as Kroger, Safeway, and Albertsons in the United States experience fierce competition and offer similar marketing campaigns to compete. What is this an example of in terms of Porters Five Forces Model? Multiple Choice rivalry among new entrants rivalry among existing competitors threat of substitute products or services buyer power how many times can you take 10 from 100?